2. Neurological Disease

Neurological Disease

Neurological Disease

Related Products

PDF 88.0 MB

A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-W020183S
    γ-Terpinene-d3
    γ-Terpinene-d3 is deuterated labeled γ-Terpinene (HY-W020183). γ-Terpinene, a monoterpene, is an orally active antioxidant compound which can scavenge radicals directly. γ-Terpinene has potent antinociception activity. γ-Terpinene exhibits antimicrobial efficacy against various bacteria and fungi.
    γ-Terpinene-d3
  • HY-W042920A
    TDIQ hydrochloride 15052-05-8
    TDIQ hydrochloride is an analog of Amphetamine with high affinity for α2-adrenergic receptor. TDIQ hydrochloride is a selective α2-adrenoceptor ligand with the Ki values of 75 nM, 95 nM, and 65 nM for α2A-, α2B-, and α2C-adrenergic receptors, respectively.
    TDIQ hydrochloride
  • HY-W073336A
    1-(3-Fluorophenyl)piperazine hydrochloride 76835-10-4
    1-(3-Fluorophenyl)piperazine hydrochloride is a piperazine.
    1-(3-Fluorophenyl)piperazine hydrochloride
  • HY-W099878A
    Desmethylclotiazepam Uncyclized Intermediate hydrochloride 74422-48-3
    Desmethylclotiazepam Uncyclized Intermediate hydrochloride is a precursor in the synthesis of Desmethylclotiazepam.
    Desmethylclotiazepam Uncyclized Intermediate hydrochloride
  • HY-W101298S
    (Leu-13C6,15N)-Ile-OH TFA
    (Leu-13C6,15N)-Ile-OH (L-Leucyl-13C6,15N-L-isoleucine) TFA is the deuterium labeled Leu-Ile-OH. Leu-Ile-OH protects against neuronal death by inducing brain-derived neurotrophic factor (BDNF) and glial cell line-derived neurotrophic factor (GDNF) synthesis.
    (Leu-13C6,15N)-Ile-OH TFA
  • HY-W1023070
    4-fluoro MBZP 144734-44-1
    4-fluoro MBZP is a new psychoactive substance that belongs to the phenylpiperazine class of compounds and can be used to study the 5-HT2 receptors in the central nervous system.
    4-fluoro MBZP
  • HY-W102714R
    1,2-Cyclohexylenedinitrilotetraacetic acid (Standard) 482-54-2
    1,2-Cyclohexylenedinitrilotetraacetic acid (Standard) is the analytical standard of 1,2-Cyclohexylenedinitrilotetraacetic acid (HY-W102714). This product is intended for research and analytical applications. 1,2-Cyclohexylenedinitrilotetraacetic acid (CDTA) is a chelating agent. 1,2-Cyclohexylenedinitrilotetraacetic acid has an ability to remove manganese from brain and liver (in vivo) and their sub-cellular fractions (in vitro), of rats pretreated with manganese sulphate.
    1,2-Cyclohexylenedinitrilotetraacetic acid (Standard)
  • HY-W105518R
    L-Carnitine tartrate (Standard) 36687-82-8
    L-Carnitine (tartrate) (Standard) is the analytical standard of L-Carnitine (tartrate). This product is intended for research and analytical applications. L-Carnitine tartrate is a highly polar, small zwitterion. L-Carnitine tartrate is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine tartrate functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine tartrate is an antioxidant. L-Carnitine tartrate can ameliorate metabolic imbalances in many inborn errors of metabolism[3].
    L-Carnitine tartrate (Standard)
  • HY-W1118061
    9-cis-13,14-Dihydroretinoic acid 176019-01-5
    9-cis-13,14-Dihydroretinoic acid (9CDHRA) is a selective retinoid X receptor (RXR) agonist with a Kd value of 90 nM. 9-cis-13,14-Dihydroretinoic acid improves memory deficits caused by impaired RXR signaling in vivo. 9-cis-13,14-Dihydroretinoic acid is promising for research of neuroscience and metabolic disease.
    9-cis-13,14-Dihydroretinoic acid
  • HY-W151617A
    Desethoxy Quetiapine dihydrochloride 329218-14-6
    Desethoxy Quetiapine dihydrochloride (Compound 28) is an antagonist for dopamine D2 receptor with an IC50 of 1330 nM. Desethoxy Quetiapine dihydrochloride antagonises Apomorphine (HY-12723)-induced climbing and swimming disruption in mouse models.
    Desethoxy Quetiapine dihydrochloride
  • HY-W201842A
    Octamylamine sulfamate 96296-56-9
    Octamylamine sulfamate is an anticholinergic and antispasmodic agent.
    Octamylamine sulfamate
  • HY-W240028A
    N-Methylmescaline hydrochloride 6308-81-2
    N-Methylmescaline hydrochloride is a phenethylamine.
    N-Methylmescaline hydrochloride
  • HY-W251284A
    3-Anilinopiperidine dihydrochloride 2751621-53-9
    3-Anilinopiperidine dihydrochloride is a piperidine.
    3-Anilinopiperidine dihydrochloride
  • HY-W424017A
    Lophophine hydrochloride 77158-52-2
    Lophophine hydrochloride is the drug intermediate of anhalonine and Lophophorine (HY-119478), and can be found in Lophophora diffusa. Anhalonine causes slight sleepiness in frog. Lophophorine causes long-lasting convulsions, reflex excitability, muscle stiffness, and paralysis in rabbit and frog model.
    Lophophine hydrochloride
  • HY-W710914A
    rel-HDMP 28 hydrochloride 219915-69-2
    rel-HDMP 28 hydrochloride (Compound 2g) is a methylphenidate analogue that binds selectively to SERT (Ki = 105 nM)[1].
    rel-HDMP 28 hydrochloride
  • HY-W746075A
    (±)-Darifenacin N-Oxide 2416229-88-2
    (±)-Darifenacin N-Oxide is the impurity of Darifenacin (HY-A0033). Darifenacin (UK-88525) is a selective and orally active M3 muscarinic receptor (M3R) antagonist with a pKi of 8.9.
    (±)-Darifenacin N-Oxide
  • HY-W783639S
    Bzo-poxizid-d9
    Bzo-poxizid-d9 (5C-MDA-19-d9, Petyl MDA-19-d9) is deuterium labeled Bzo-poxizid. Bzo-poxizid is a synthetic cannabinoid that is a psychoactive substance.
    Bzo-poxizid-d9
  • HY-W012531S2
    2-Hydroxycinnamic acid-d4
    2-Hydroxycinnamic acid-d4 is deuterium labeled 2-Hydroxycinnamic acid. 2-Hydroxycinnamic acid is a phenolic acid with antimicrobial and antioxidant properties. 2-Hydroxycinnamic acid has antimicrobial activity against Staphylococcus aureus and is not susceptible to drug resistance. 2-Hydroxycinnamic acid shows inhibitory effects on infection of HIV/SARS-CoV S pseudovirus with an IC50 of 0.3 mM. In addition, 2-Hydroxycinnamic acid has neuroprotective and antitumor activity.
    2-Hydroxycinnamic acid-d4
  • HY-W012889S3
    DL-Valine-d1-1 79168-24-4
    DL-Valine-d-1 is the deuterium labeled DL-Valine[1].
    DL-Valine-d1-1
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW 2279952-25-7
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
Cat. No. Product Name / Synonyms Application Reactivity